PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_30912-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 128aa    MW: 14293.4 Da    PI: 11.4673
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_30912-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.3e-131660347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  TRIUR3_30912-P1 16 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 60
                     7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.873965IPR017930Myb domain
SuperFamilySSF466891.29E-171166IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-181363IPR006447Myb domain, plants
SMARTSM007172.3E-101363IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-111459IPR009057Homeodomain-like
CDDcd001679.28E-111661No hitNo description
PfamPF002491.6E-111660IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
GKGCSKAEQE RRKGIPWTEE EHRLFLLGLD KFGKGDWRSI SRNFVISRTP TQVASHAQKY  60
FIRLNSMNRD RRRSSIHDIT SIQRRPGRAP MGHPVAGHMV PAAVGTPVMF PPGPGHPPYA  120
MPVGYPAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519481e-137JF951948.1 Triticum aestivum clone TaMYB65 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565794.16e-71PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-39DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLT1NJR72e-91T1NJR7_TRIUA; Uncharacterized protein
STRINGBRADI2G13860.12e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94663041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-37MYB family protein